PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000151688
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 494aa    MW: 53884.4 Da    PI: 6.3684
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000151688genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding513.4e-163885148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed +lv++vk++G g+W+++ +  g+ R++k+c++rw ++l
    MDP0000151688 38 KGPWTGAEDAILVEYVKKHGEGNWNAVQKNSGLARCGKSCRLRWANHL 85
                     79******************************************9986 PP

2Myb_DNA-binding46.58.3e-1591134146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g+ ++eE+ l++++++++G++ W++ a+ ++ gRt++++k++w++
    MDP0000151688  91 KGSLSPEEERLIIELHAKFGNK-WARMASQLP-GRTDNEIKNYWNT 134
                      57789*****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.0963385IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-223388IPR009057Homeodomain-like
SuperFamilySSF466891.16E-2935132IPR009057Homeodomain-like
SMARTSM007179.2E-143787IPR001005SANT/Myb domain
PfamPF002491.9E-143885IPR001005SANT/Myb domain
CDDcd001672.18E-114085No hitNo description
PROSITE profilePS5129425.35986140IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-2489139IPR009057Homeodomain-like
SMARTSM007172.0E-1590138IPR001005SANT/Myb domain
PfamPF002495.8E-1491134IPR001005SANT/Myb domain
CDDcd001671.17E-1195134No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 494 aa     Download sequence    Send to blast
MIINNSGVMD RVXETAVGAQ RGGSHHHHNH HHQRGLKKGP WTGAEDAILV EYVKKHGEGN  60
WNAVQKNSGL ARCGKSCRLR WANHLRPNLK KGSLSPEEER LIIELHAKFG NKWARMASQL  120
PGRTDNEIKN YWNTRMKRRQ RAGLPVYPHD LQQEAAAAAF HHQHQLRHSS SSPASSFSSL  180
FSSSHPRKPN SFCPSQLSLY DHITSTFSST SDHQNPNNNY FLQNHHHNSS SLYSNPMTQF  240
HGNGGFAMPL SPVSPFGSSA LFNQSNIPNQ TLIGQYNSHG GFGGYNNLSL SSMIMGPPTY  300
DPTPLVQGSN PELPSNQTPL SINGGSEGQM GGSGYTANED HYEIAPVPSQ GXSGLLDDVL  360
VEAQNISNKK AKSGDSCSSG WSGQEKGLMV EXEEEEESAE EEAEDTVQVE STLKNSGENS  420
AENQRGGSSS LSSIGMIQNE DPLEEMDDDL LSLLNFPSTM PAVSESWYAQ GCMSNRASMS  480
GVSTSDNVSL EIAK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-31361395107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008379641.10.0PREDICTED: transcription factor RAX1
TrEMBLM5XAE20.0M5XAE2_PRUPE; Uncharacterized protein
STRINGGLYMA13G38521.11e-108(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF99493240
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.12e-74myb domain protein 101